PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PH01000436G0190
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Bambusoideae; Arundinarodae; Arundinarieae; Arundinariinae; Phyllostachys
Family bZIP
Protein Properties Length: 548aa    MW: 57931.4 Da    PI: 7.9278
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PH01000436G0190genomeICBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_143.66.3e-1495157163
                      XXXXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
           bZIP_1   1 ekelkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                      e+e kr  r+ +NRe+A  sR+RK++++eeLe kvk+++a   +L  +++  + e a+lk+++
  PH01000436G0190  95 EEEAKRRARLVRNRESAHLSRERKRQYVEELEGKVKAMQATIADLTARISCFTAENAALKQQL 157
                      7899********************************************************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1701.0E-1588157No hitNo description
PfamPF001703.3E-1295157IPR004827Basic-leucine zipper domain
SMARTSM003386.7E-1395159IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.11797157IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.88E-1299157No hitNo description
CDDcd147044.69E-20100151No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 548 aa     Download sequence    Send to blast
MASAREGSLS GRLAGDLRDF DLDDLDLDFD LDLFSTDVQF PPPLATSSSS AGSPDGGSSS  60
SGAGGDGSLR NEESSESSSR GASAGSNSKP KGGDEEEAKR RARLVRNRES AHLSRERKRQ  120
YVEELEGKVK AMQATIADLT ARISCFTAEN AALKQQLGGA GGRGAPPPLP MYPAVYPLPP  180
PWIHPAYAMR GSQVPLVPIP RLKTQRSAPT VVEPPAKKAR KTKKVASVSL LGLLFLVMVC  240
GCLVPAVNRM YGAVDPGEGA AFGPPHHGRV LAVEGPQNSA SDGIDSKVPQ DGSETLPALL  300
YLPRNGKHVK INGNLVIKSI VASEKASLRM SNYSGKSSGS QGKEETSLAI PGYAASLEPG  360
EVMESAKGMK KELMALAPGD GSVYREEDGM LPQWFSEAMS GPMLSSGTCT EVFHFDLSPT  420
SAHANGIVPV YSNAMSNSSQ NFTENLPSGP AQKVKNRRIL YSEAIPLQGS TSNDTEHLKA  480
TPKNESYASS KPVSSVVVSV LADPREDGEG RISPKSLSRI FVVVLVDSVK YVTYSCVLPF  540
KNHSPHL*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006658038.10.0PREDICTED: bZIP transcription factor 17-like
TrEMBLA0A0E0LP010.0A0A0E0LP01_ORYPU; Uncharacterized protein
STRINGOB07G29670.10.0(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP111793035
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40950.17e-73bZIP family protein